PDB entry 1ode

View 1ode on RCSB PDB site
Description: crystal analysis of chorismate mutase from thermus thermophilus.
Class: isomerase
Keywords: isomerase, chorismate mutase, shikimate pathway, mutant, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-02-18, released 2003-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.213
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODE (0-End)
    Domains in SCOPe 2.06: d1odea_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODE (0-End)
    Domains in SCOPe 2.06: d1odeb_
  • Chain 'C':
    Compound: chorismate mutase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODE (0-End)
    Domains in SCOPe 2.06: d1odec_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odeA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odeB (B:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeB (B:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odeC (C:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeC (C:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp