PDB entry 1ode

View 1ode on RCSB PDB site
Description: crystal analysis of chorismate mutase from thermus thermophilus.
Deposited on 2003-02-18, released 2003-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-27, with a file datestamp of 2003-02-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.213
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1odea_
  • Chain 'B':
    Domains in SCOP 1.67: d1odeb_
  • Chain 'C':
    Domains in SCOP 1.67: d1odec_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odeA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odeB (B:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeB (B:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odeC (C:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odeC (C:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp