PDB entry 1odd

View 1odd on RCSB PDB site
Description: ompr c-terminal domain (ompr-c) from escherichia coli
Class: gene regulatory protein
Keywords: gene regulatory protein, positive response regulator, DNA binding domain
Deposited on 1996-10-31, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein ompR
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1odda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oddA (A:)
    rqanelpgapsqeeaviafgkfklnlgtremfredepmpltsgefavlkalvshprepls
    rdklmnlargreysamersidvqisrlrrmveedpahpryiqtvwglgyvfvpdgska
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oddA (A:)
    aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys
    amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd