PDB entry 1odb

View 1odb on RCSB PDB site
Description: the crystal structure of human s100a12 - copper complex
Class: metal-binding protein
Keywords: metal-binding protein, calcium-binding protein, s100 protein, ef-hand, calcium binding, host-parasite response
Deposited on 2003-02-15, released 2003-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odba_
  • Chain 'B':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odbb_
  • Chain 'C':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odbc_
  • Chain 'D':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odbd_
  • Chain 'E':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odbe_
  • Chain 'F':
    Compound: calgranulin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ODB (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.05: d1odbf_
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odbA (A:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbA (A:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odbB (B:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbB (B:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odbC (C:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbC (C:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1odbD (D:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbD (D:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1odbE (E:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbE (E:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1odbF (F:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odbF (F:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhth