PDB entry 1oda

View 1oda on RCSB PDB site
Description: n-terminal of sialoadhesin in complex with me-a-9-n-(biphenyl-4-carbonyl)-amino-9-deoxy-neu5ac (bip compound)
Class: lectin/immune system
Keywords: lectin/immune system, immune system, immunoglobulin superfamily, carbohydrate binding, siglec, inhibitor design, cell adhesion
Deposited on 2003-02-14, released 2003-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sialoadhesin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62230 (0-118)
  Domains in SCOPe 2.08: d1odaa_
• Heterogens: BDU

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1odaA (A:)
  twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
  dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1odaA (A:)
  twgvsspknvqglsgscllipcifsypadvpvgitaiwyydysgkrqvvihsgdpklvdk
  rfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd