PDB entry 1od8

View 1od8 on RCSB PDB site
Description: xylanase xyn10a from streptomyces lividans in complex with xylobio- isofagomine lactam
Deposited on 2003-02-14, released 2003-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-04-25, with a file datestamp of 2003-04-25.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.10403
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1od8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od8A (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od8A (A:)
    estlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnf
    ssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgkiv
    qwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwak
    tqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqg
    apastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldaln
    gg