PDB entry 1od6

View 1od6 on RCSB PDB site
Description: the crystal structure of phosphopantetheine adenylyltransferase from thermus thermophilus in complex with 4'-phosphopantetheine
Class: transferase
Keywords: coenzyme a biosynthesis, transferase, nucleotidyltransferase, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-02-13, released 2003-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OD6 (0-159)
    Domains in SCOPe 2.05: d1od6a_
  • Heterogens: PNS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1od6A (A:)
mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata
hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila
atrysfvsstmvkeiaryggdvsklvppatlralkaklgq

    Sequence, based on observed residues (ATOM records): (download) 
    >1od6A (A:)
mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv
eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys
fvsstmvkeiaryggdvsklvppatlralkaklgq