PDB entry 1od6

View 1od6 on RCSB PDB site
Description:
Deposited on 2003-02-13, released 2003-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-13, with a file datestamp of 2003-03-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1od6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od6A (A:)
    mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata
    hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila
    atrysfvsstmvkeiaryggdvsklvppatlralkaklgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od6A (A:)
    mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv
    eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys
    fvsstmvkeiaryggdvsklvppatlralkaklgq