PDB entry 1od6

View 1od6 on RCSB PDB site
Description: The Crystal Structure of Phosphopantetheine adenylyltransferase from Thermus Thermophilus in complex with 4'-phosphopantetheine
Class: transferase
Keywords: coenzyme a biosynthesis, transferase, nucleotidyltransferase, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-02-13, released 2003-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1od6a_
  • Heterogens: PNS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od6A (A:)
    mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata
    hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila
    atrysfvsstmvkeiaryggdvsklvppatlralkaklgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od6A (A:)
    mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv
    eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys
    fvsstmvkeiaryggdvsklvppatlralkaklgq