PDB entry 1od4

View 1od4 on RCSB PDB site
Description: Acetyl-CoA Carboxylase Carboxyltransferase Domain
Class: ligase
Keywords: acc, acetyl-coa carboxylase, obesity, ligase
Deposited on 2003-02-12, released 2003-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1od4a1, d1od4a2
  • Chain 'B':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1od4b1, d1od4b2
  • Chain 'C':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1od4c1, d1od4c2
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od4A (A:)
    ikdpqtgapvplralinnvsgyviktemytevknakgewvfkslgkpgsmhlrpiatpyp
    vkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedeng
    elteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvt
    eyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkk
    fdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlv
    tcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngv
    shltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmie
    gretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpa
    npnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevl
    kygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepq
    gmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygq
    islqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasr
    lekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkirsdhdn
    aidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od4A (A:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviske
    lewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqva
    twieenyktlddklkglklesfaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1od4B (B:)
    ikdpqtgapvplralinnvsgyviktemytevknakgewvfkslgkpgsmhlrpiatpyp
    vkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedeng
    elteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvt
    eyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkk
    fdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlv
    tcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngv
    shltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmie
    gretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpa
    npnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevl
    kygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepq
    gmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygq
    islqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasr
    lekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkirsdhdn
    aidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od4B (B:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviske
    lewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqva
    twieenyktlddklkglklesfaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1od4C (C:)
    ikdpqtgapvplralinnvsgyviktemytevknakgewvfkslgkpgsmhlrpiatpyp
    vkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedeng
    elteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvt
    eyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkk
    fdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlv
    tcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngv
    shltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmie
    gretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpa
    npnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevl
    kygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepq
    gmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygq
    islqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasr
    lekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkirsdhdn
    aidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od4C (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkyg
    sfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmv
    gikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearrfffw
    rlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktldd
    klkglklesfaq