PDB entry 1od3

View 1od3 on RCSB PDB site
Description: structure of cscbm6-3 from clostridium stercorarium in complex with laminaribiose
Class: hydrolase
Keywords: hydrolase, carbohydrate binding module, beta-sandwich, laminaribiose
Deposited on 2003-02-12, released 2003-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.132
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative xylanase
    Species: Clostridium stercorarium [TaxId:1510]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OD3
    • Uniprot Q93AQ5 (35-End)
    Domains in SCOPe 2.07: d1od3a_
  • Heterogens: ACY, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od3A (A:)
    mgsshhhhhhssglvprgshmastpanvnsgptspvggtrsafsniqaedydssygpnlq
    ifslpgggsaigyiengysttyknidfgdgatsvtarvatqnattiqvrlgspsgtllgt
    iyvgstgsfdtyrdvsatisntagvkdivlvfsgpvnvdwfvfsksgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od3A (A:)
    vggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvt
    arvatqnattiqvrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgp
    vnvdwfvfsksg