PDB entry 1od2

View 1od2 on RCSB PDB site
Description: Acetyl-CoA Carboxylase Carboxyltransferase Domain
Class: ligase
Keywords: ligase, acc, acetyl-coa, acetyl-coa carboxylase, obesity
Deposited on 2003-02-12, released 2003-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1od2a1, d1od2a2
  • Chain 'B':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1od2b1, d1od2b2
  • Heterogens: ACO, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od2A (A:)
    ikdpqtgapvplralinnvsgyviktemytevknakgewvfkslgkpgsmhlrpiatpyp
    vkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedeng
    elteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvt
    eyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkk
    fdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlv
    tcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngv
    shltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmie
    gretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpa
    npnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevl
    kygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepq
    gmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygq
    islqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasr
    lekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkirsdhdn
    aidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od2A (A:)
    atpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneli
    edengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedef
    fnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegm
    etlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdif
    titlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqim
    ynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydv
    rwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenli
    padpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdm
    fnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnarag
    vlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerell
    piygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqv
    geasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1od2B (B:)
    ikdpqtgapvplralinnvsgyviktemytevknakgewvfkslgkpgsmhlrpiatpyp
    vkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedeng
    elteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvt
    eyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkk
    fdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlv
    tcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngv
    shltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmie
    gretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpa
    npnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevl
    kygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepq
    gmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygq
    islqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasr
    lekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakkirsdhdn
    aidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od2B (B:)
    pkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelteve
    repganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteyarkr
    gipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdkens
    vltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcrsvg
    igaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshltav
    ddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegretes
    gfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpnsae
    tliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfi
    vdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmvgik
    frreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygqislqfa
    dlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiar
    irswypasvdheddrqvatwieenyktlddklkglk