PDB entry 1od0

View 1od0 on RCSB PDB site
Description: family 1 b-glucosidase from thermotoga maritima
Class: hydrolase
Keywords: hydrolase, glucoside hydrolysis, family gh1, enzyme, glycosidase,hydrolase,cellulose degradation
Deposited on 2003-02-12, released 2003-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.21333
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1od0a_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1od0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od0A (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od0A (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepaseravrfmhqfnn
    yplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfdpakv
    sfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrvhdqn
    ridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkrivkd
    sgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1od0B (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od0B (B:)
    hmasnvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdh
    ynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfv
    tiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghly
    gvhapgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeedira
    vrfmhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysgh
    lvkfdpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddv
    vsedgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyv
    dystqkrivkdsgywysnvvknngle