PDB entry 1ocx

View 1ocx on RCSB PDB site
Description: e. coli maltose-o-acetyltransferase
Class: transferase
Keywords: transferase, acetyl transferase, left-handed parallel beta-helix
Deposited on 2003-02-11, released 2003-06-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ocxa_
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ocxb_
  • Chain 'C':
    Compound: maltose o-acetyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ocxc_
  • Heterogens: PBM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocxA (A:)
    stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
    ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
    sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
    kl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocxB (B:)
    stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
    ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
    sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
    kl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocxC (C:)
    stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
    ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
    sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
    kl