PDB entry 1oct

View 1oct on RCSB PDB site
Description: crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1octC (C:)
    dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
    pllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksflenqk
    ptseeitmiadqlnmekevirvwfcnrrqkekrinp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1octC (C:)
    dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
    pllekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfc
    nrrqkekrinp