PDB entry 1oct

View 1oct on RCSB PDB site
Description: crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with tethered DNA-binding modules
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA complex
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*gp*cp*ap*ap*ap*tp*ap*ap*gp*g)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*cp*cp*tp*tp*ap*tp*tp*tp*gp*cp*ap*tp*ap*c)-3')
  • Chain 'C':
    Compound: protein (oct-1 pou domain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1octc1, d1octc2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1octC (C:)
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksflenqk
ptseeitmiadqlnmekevirvwfcnrrqkekrinp

    Sequence, based on observed residues (ATOM records): (download) 
    >1octC (C:)
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfc
nrrqkekrinp