PDB entry 1ocs

View 1ocs on RCSB PDB site
Description: crystal structure of the yeast px-doamin protein grd19p (sorting nexin3) complexed to phosphatidylinosytol-3-phosphate.
Deposited on 2003-02-10, released 2003-12-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-12, with a file datestamp of 2003-12-12.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.2173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ocsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ocsA (A:)
    mprefksfgsteksllskghgepsyseiyaepenfleievhnpkthipngmdskgmftdy
    eiicrtnlpsfhkrvskvrrrysdfeffrkclikeismlnhpkvmvphlpgkillsnrfs
    nevieerrqglntwmqsvaghpllqsgskvlvrfieaekfvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ocsA (A:)
    aepenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfeffr
    kclikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsgsk
    vlvrfieaekfv