PDB entry 1ocs

View 1ocs on RCSB PDB site
Description: crystal structure of the yeast px-doamin protein grd19p (sorting nexin3) complexed to phosphatidylinosytol-3-phosphate.
Class: sorting protein
Keywords: sorting protein, sorting nexin, px-domain, yeast protein
Deposited on 2003-02-10, released 2003-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.2173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorting nexin grd19
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ocsa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ocsA (A:)
    mprefksfgsteksllskghgepsyseiyaepenfleievhnpkthipngmdskgmftdy
    eiicrtnlpsfhkrvskvrrrysdfeffrkclikeismlnhpkvmvphlpgkillsnrfs
    nevieerrqglntwmqsvaghpllqsgskvlvrfieaekfvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ocsA (A:)
    aepenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfeffr
    kclikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsgsk
    vlvrfieaekfv