PDB entry 1ocm

View 1ocm on RCSB PDB site
Description: the crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum
Class: amidase
Keywords: amidase, malonamidase
Deposited on 2003-02-08, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malonamidase e2
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIV5 (0-399)
    • PDB 1OCM (400-411)
    Domains in SCOPe 2.07: d1ocma_
  • Chain 'B':
    Compound: malonamidase e2
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIV5 (0-399)
    • PDB 1OCM (400-411)
    Domains in SCOPe 2.07: d1ocmb_
  • Heterogens: POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocmA (A:)
    misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
    ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
    phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
    kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
    qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
    rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
    ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocmB (B:)
    misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
    ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
    phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
    kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
    qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
    rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
    ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak