PDB entry 1oc4

View 1oc4 on RCSB PDB site
Description: lactate dehydrogenase from plasmodium berghei
Class: oxidoreductase
Keywords: lactate dehydrogenase, oxidoreductase, glycolysis, interconversion of pyruvate and lactate, 3-layer (aba) sandwich
Deposited on 2003-02-05, released 2003-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: PLASMODIUM BERGHEI [TaxId:5821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oc4a1, d1oc4a2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: PLASMODIUM BERGHEI [TaxId:5821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oc4b1, d1oc4b2
  • Heterogens: NAD, OXM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oc4A (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpna
    fiivvtnpvdvmvqllhqhsgvpknkivglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnkkitdqeldaifdrtintaleivnlhaspyvapa
    aaiiemaesyirdlrkvlicstllegqyghkdifagtplviggngveqvielqlnadekk
    kfdeavaetsrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc4A (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpnaf
    iivvtnpvdvmvqllhqhsgvpknkivglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnkkitdqeldaifdrtintaleivnlhaspyvapaa
    aiiemaesyirdlrkvlicstllegqyghkdifagtplviggngveqvielqlnadekkk
    fdeavaetsrmkali
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oc4B (B:)
    mapkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpna
    fiivvtnpvdvmvqllhqhsgvpknkivglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnkkitdqeldaifdrtintaleivnlhaspyvapa
    aaiiemaesyirdlrkvlicstllegqyghkdifagtplviggngveqvielqlnadekk
    kfdeavaetsrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc4B (B:)
    apkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpnaf
    iivvtnpvdvmvqllhqhsgvpknkivglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnkkitdqeldaifdrtintaleivnlhaspyvapaa
    aiiemaesyirdlrkvlicstllegqyghkdifagtplviggngveqvielqlnadekkk
    fdeavaetsrmkali