PDB entry 1oc1

View 1oc1 on RCSB PDB site
Description: isopenicillin n synthase aminoadipoyl-cysteinyl-aminobutyrate-fe complex
Deposited on 2003-02-03, released 2004-02-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-02, with a file datestamp of 2004-02-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17407
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oc1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oc1A (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc1A (A:)
    svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
    msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
    thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
    svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
    eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
    ngksdreplsygdylqnglvslinkngqt