PDB entry 1oc0

View 1oc0 on RCSB PDB site
Description: plasminogen activator inhibitor-1 complex with somatomedin b domain of vitronectin
Class: hydrolase/inhibitor
Keywords: hydrolase/inhibitor, serine protease inhibitor/complex, serpin, proteinase inhibitor, fibrinolysis, cell migration, plasminogen activation, heparin-binding, cell adhesion
Deposited on 2003-02-03, released 2003-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.06: d1oc0a_
  • Chain 'B':
    Compound: Vitronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oc0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oc0A (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc0A (A:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvalalqkvkievnesgtvassapeeiiidrpflfvvrhnptgtvlfmgq
    vmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oc0B (B:)
    dqesckgrctegfnvdkkcqcdelcsyyqscctdytaeckpqvtrgdvftm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oc0B (B:)
    esckgrctegfnvdkkcqcdelcsyyqscctdytaec