PDB entry 1oby

View 1oby on RCSB PDB site
Description: crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
Class: cell adhesion
Keywords: cell adhesion, adhesion/complex, pdz domain, signal transduction, nuclear protein
Deposited on 2003-01-31, released 2003-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBY (Start-4)
    • Uniprot O00560 (5-78)
    Domains in SCOPe 2.06: d1obya1, d1obya2
  • Chain 'B':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBY
    • Uniprot O00560 (5-78)
    Domains in SCOPe 2.06: d1obyb_
  • Chain 'P':
    Compound: syndecan-4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: syndecan-4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1obyA (A:)
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitim

    Sequence, based on observed residues (ATOM records): (download) 
    >1obyA (A:)
prtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqia
dilstsgtvvtitim

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1obyB (B:)
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitim

    Sequence, based on observed residues (ATOM records): (download) 
    >1obyB (B:)
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitim

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.