PDB entry 1obx

View 1obx on RCSB PDB site
Description: crystal structure of the complex of pdz2 of syntenin with an interleukin 5 receptor alpha peptide.
Class: cell adhesion
Keywords: cell adhesion, adhesion/complex, pdz domain, signal transduction, nuclear protein,
Deposited on 2003-01-31, released 2003-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.177
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBX
    • Uniprot O00560 (5-78)
    Domains in SCOPe 2.05: d1obxa_
  • Chain 'B':
    Compound: interleukin 5 receptor alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obxA (A:)
    gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
    sqiadilstsgtvvtitim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obxA (A:)
    rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
    ilstsgtvvtitim
    

  • Chain 'B':
    No sequence available.