PDB entry 1obx

View 1obx on RCSB PDB site
Description: crystal structure of the complex of pdz2 of syntenin with an interleukin 5 receptor alpha peptide.
Deposited on 2003-01-31, released 2003-07-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-10, with a file datestamp of 2003-07-10.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.17737
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1obxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1obxA (A:)
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitim

    Sequence, based on observed residues (ATOM records): (download) 
    >1obxA (A:)
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitim