PDB entry 1obx

View 1obx on RCSB PDB site
Description: Crystal structure of the complex of PDZ2 of syntenin with an interleukin 5 receptor alpha peptide.
Class: cell adhesion
Keywords: cell adhesion, adhesion-complex, pdz domain, signal transduction, nuclear protein
Deposited on 2003-01-31, released 2003-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Syntenin 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1OBX
  • Uniprot O00560 (5-78)
  Domains in SCOPe 2.08: d1obxa_
• Chain 'B':
  Compound: interleukin 5 receptor alpha
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01344 (Start-7)
• Heterogens: CO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1obxA (A:)
  gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
  sqiadilstsgtvvtitim
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1obxA (A:)
  rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
  ilstsgtvvtitim
  

  
  
• Chain 'B':
  No sequence available.