PDB entry 1obv

View 1obv on RCSB PDB site
Description: y94f flavodoxin from anabaena
Class: electron transfer
Keywords: electron transfer, flavoprotein, electron transport
Deposited on 2003-01-31, released 2003-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBV (0-0)
      • engineered mutation (93)
    • Uniprot P11241 (1-168)
    Domains in SCOPe 2.06: d1obva_
  • Heterogens: FMN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obvA (A:)
    akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    elqsdweglyselddvdfngklvayfgtgdqigfadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl