PDB entry 1obr

View 1obr on RCSB PDB site
Description: carboxypeptidase t
Class: hydrolase
Keywords: hydrolase, carboxypeptidase
Deposited on 1996-06-22, released 1997-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.152
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase t
    Species: Thermoactinomyces vulgaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1obra_
  • Heterogens: ZN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obrA (A:)
    dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
    evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
    ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
    amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
    aqtngytpqqasdlyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
    nkeavlyvaekadcpysvigkscstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obrA (A:)
    dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
    evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
    ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
    amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
    aqtngytpqqasdlyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
    nkeavlyvaekadcpysvigksc