PDB entry 1obo

View 1obo on RCSB PDB site
Description: w57l flavodoxin from anabaena
Class: electron transfer
Keywords: electron transfer, flavoprotein, electron transport
Deposited on 2003-01-31, released 2003-04-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.186
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241
      • conflict see remark 9 (0)
      • engineered (56)
    Domains in SCOPe 2.02: d1oboa_
  • Chain 'B':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241 (0-168)
      • conflict see remark 9 (0)
      • engineered (56)
    Domains in SCOPe 2.02: d1obob_
  • Heterogens: FMN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oboA (A:)
    akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oboB (B:)
    akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl