PDB entry 1obm

View 1obm on RCSB PDB site
Description: recombinant sperm whale myoglobin 29f/64q/68f/122n mutant (met)
Class: oxygen transport
Keywords: oxygen binding muscle protein, oxygen transport
Deposited on 1997-12-19, released 1998-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • engineered (29)
      • engineered (64)
      • engineered (68)
      • engineered (122)
    Domains in SCOPe 2.05: d1obma_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obmA (A:)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg