PDB entry 1obh

View 1obh on RCSB PDB site
Description: leucyl-tRNA synthetase from thermus thermophilus complexed with a pre-transfer editing substrate analogue in both synthetic active site and editing site
Class: synthetase
Keywords: synthetase, aminoacyl-tRNA synthetase, class I aminoacyl-tRNA synthetase, ATP + l-leucine + tRNA (leu) -> amp + ppi l- leucyl-tRNA(leu)
Deposited on 2003-01-31, released 2003-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBH (0-End)
    Domains in SCOPe 2.06: d1obha1, d1obha2, d1obha3
  • Heterogens: SO4, HG, NVA, LMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obhA (A:)
    mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
    vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
    wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
    dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegke
    vripvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegr
    ektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikk
    vierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlr
    dwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefy
    ettcpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggve
    havlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptr
    irleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadia
    ritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdre
    lygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlf
    pfaphlaeelwhwfwpdslfeagwpeldekalekdvvevavqvngrvrgtihipkdaple
    varaealkvrnvrahlegkevvkeiyvpgkilnlvvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obhA (A:)
    mekynphaieakwqrfweekgfmkakdlpgggkqyvlvmfpypsgdlhmghlknytmgdv
    larfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilydw
    drevttcepeyyrwnqwiflkmwekglayrakeqwylritayaerllkdleglnwpekvk
    amqrawigrsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekr
    eevlayveaakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgai
    mavpahdqrdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseeg
    krkviawleekglgkgrvtyrlrdwlisrqrywgtpipmvhcvvpvpeeelpvllpdlkd
    vedispleahpefyettcpkrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpv
    dqyiggvehavlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsv
    vrlpeptrirleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfv
    keqgadiaritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqae
    alegkdrelygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtai
    ryylqmlfpfaphlaeelwhwfwpdslfeagwpeldekalek