PDB entry 1obg

View 1obg on RCSB PDB site
Description: saicar-synthase complexed with ATP
Class: synthetase
Keywords: ATP binding protein, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) synthase, purine biosynthesis
Deposited on 2003-01-30, released 2003-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-06, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylamidoimidazole-succinocarboxamide synthase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1obga_
  • Heterogens: SO4, MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obgA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh