PDB entry 1obf

View 1obf on RCSB PDB site
Description: The crystal structure of Glyceraldehyde 3-phosphate Dehydrogenase from Alcaligenes xylosoxidans at 1.7A resolution.
Deposited on 2003-01-30, released 2003-06-12
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-12, with a file datestamp of 2003-06-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16701
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obfO (O:)
    tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
    svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
    isapggadvdatvvygvnhgtlkstdtvisnascttnclaplvkplndklglqdglmttv
    haytnnqvltdvyhedlrrarsatmsmiptktgaaaavgdvlpeldgklngyairvptin
    vsivdlsfvakrnttveevngilkaasegelkgildynteplvsvdynhdpasstvdasl
    tkvsgrlvkvsswydnewgfsnrmldttvalmsaa
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obfP (P:)
    tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
    svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
    isapggadvdatvvygvnhgtlkstdtvisnascttnclaplvkplndklglqdglmttv
    haytnnqvltdvyhedlrrarsatmsmiptktgaaaavgdvlpeldgklngyairvptin
    vsivdlsfvakrnttveevngilkaasegelkgildynteplvsvdynhdpasstvdasl
    tkvsgrlvkvsswydnewgfsnrmldttvalmsaa