PDB entry 1obf

View 1obf on RCSB PDB site
Description: The crystal structure of Glyceraldehyde 3-phosphate Dehydrogenase from Alcaligenes xylosoxidans at 1.7A resolution.
Class: glycolytic pathway
Keywords: glycolytic pathway, oxidoreductase, free-nad gapdh
Deposited on 2003-01-30, released 2003-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16701
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBF (0-334)
    Domains in SCOPe 2.07: d1obfo1, d1obfo2
  • Chain 'P':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBF (0-334)
    Domains in SCOPe 2.07: d1obfp1, d1obfp2
  • Heterogens: SO4, K, PG4, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obfO (O:)
    tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
    svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
    isapggadvdatvvygvnhgtlkstdtvisnascttnclaplvkplndklglqdglmttv
    haytnnqvltdvyhedlrrarsatmsmiptktgaaaavgdvlpeldgklngyairvptin
    vsivdlsfvakrnttveevngilkaasegelkgildynteplvsvdynhdpasstvdasl
    tkvsgrlvkvsswydnewgfsnrmldttvalmsaa
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1obfP (P:)
    tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
    svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
    isapggadvdatvvygvnhgtlkstdtvisnascttnclaplvkplndklglqdglmttv
    haytnnqvltdvyhedlrrarsatmsmiptktgaaaavgdvlpeldgklngyairvptin
    vsivdlsfvakrnttveevngilkaasegelkgildynteplvsvdynhdpasstvdasl
    tkvsgrlvkvsswydnewgfsnrmldttvalmsaa