PDB entry 1obd

View 1obd on RCSB PDB site
Description: saicar-synthase complexed with ATP
Class: synthetase
Keywords: ATP binding protein, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) synthase, purine biosynthesis, ligase
Deposited on 2003-01-30, released 2003-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-06, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.15621
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylamidoimidazole-succinocarboxamide synthase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1obda_
  • Heterogens: SO4, MG, ACE, ATP, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obdA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obdA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkadenispaqaaelvged
    lsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwng
    asykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw