PDB entry 1obd

View 1obd on RCSB PDB site
Description: saicar-synthase complexed with atp
Deposited on 2003-01-30, released 2003-03-06
The last revision prior to the SCOP 1.69 freeze date was dated 2003-03-06, with a file datestamp of 2003-03-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.15621
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1obda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obdA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obdA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkadenispaqaaelvged
    lsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwng
    asykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw