PDB entry 1obc

View 1obc on RCSB PDB site
Description: leucyl-tRNA synthetase from thermus thermophilus complexed with a post-transfer editing substrate analogue
Class: synthetase
Keywords: aminoacyl-tRNA synthetase, class I aminoacyl-tRNA synthetase, ATP + l-leucine + tRNA (leu) -> amp + ppi l-leucyl-tRNA(leu), synthetase
Deposited on 2003-01-30, released 2003-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OBC (0-End)
    Domains in SCOPe 2.07: d1obca1, d1obca2, d1obca3
  • Heterogens: LEU, ZN, NVA, 2AD, LMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obcA (A:)
    mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
    vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
    wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
    dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegke
    vripvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegr
    ektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikk
    vierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlr
    dwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefy
    ettcpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggve
    havlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptr
    irleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadia
    ritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdre
    lygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlf
    pfaphlaeelwhwfwpdslfeagwpeldekalekdvvevavqvngrvrgtihipkdaple
    varaealkvrnvrahlegkevvkeiyvpgkilnlvvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obcA (A:)
    mekynphaieakwqrfweekgfmkakdlpgkqyvlvmfpypsgdlhmghlknytmgdvla
    rfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilydwdr
    evttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhedtp
    vekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegkevri
    pvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegrekt
    gvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikkvie
    rpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlrdwl
    isrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefyett
    cpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggvehav
    lhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptrirl
    eipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadiarit
    ilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdrelyg
    klhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlfpfa
    phlaeelwhwfwpdslfeagwpeldekalek