PDB entry 1ob5

View 1ob5 on RCSB PDB site
Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a GTP analog, and phe-tRNA
Class: hydrolase
Keywords: hydrolase, gtpase, translation elongation factor, transfer RNA, GTP-binding, nucleotide-binding, protein biosynthesis
Deposited on 2003-01-24, released 2005-10-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2796
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ob5a1, d1ob5a2, d1ob5a3
  • Chain 'B':
    Compound: transfer-RNA, phe
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Chain 'C':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ob5c1, d1ob5c2, d1ob5c3
  • Chain 'D':
    Compound: transfer-RNA, phe
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Chain 'E':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ob5e1, d1ob5e2, d1ob5e3
  • Chain 'F':
    Compound: transfer-RNA, phe
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Heterogens: GNP, MG, ENX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ob5A (A:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ob5A (A:)
    irtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitint
    ahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarq
    vgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhkn
    pktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgrierg
    kvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvla
    kpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpg
    dnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ob5C (C:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ob5C (C:)
    irtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitint
    ahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarq
    vgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhkn
    pktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgrierg
    kvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvla
    kpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpg
    dnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ob5E (E:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ob5E (E:)
    irtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitint
    ahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarq
    vgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhkn
    pktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgrierg
    kvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvla
    kpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpg
    dnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'F':
    No sequence available.