PDB entry 1ob2

View 1ob2 on RCSB PDB site
Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a GTP analog, and phe-tRNA
Class: hydrolase/nuclear protein
Keywords: hydrolase/nuclear protein, hydrolase, gtpase, translation elongation factor, transfer RNA
Deposited on 2003-01-24, released 2004-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.22
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6N1 (0-392)
      • conflict (0)
    Domains in SCOPe 2.01: d1ob2a1, d1ob2a2, d1ob2a3
  • Chain 'B':
    Compound: transfer-RNA, phe
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Heterogens: KIR, SUC, GNP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob2A (A:)
    akekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    No sequence available.