PDB entry 1ob1

View 1ob1 on RCSB PDB site
Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19
Class: immunoglobulin/complex
Keywords: immunoglobulin, antibody fab fragment, msp1-19, egf-like domain, surface antigen, malaria vaccine component, merozoite surface protein 1
Deposited on 2003-01-22, released 2003-05-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody, heavy chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1ob1a1, d1ob1a2
  • Chain 'B':
    Compound: antibody, light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1ob1b1, d1ob1b2
  • Chain 'C':
    Compound: Merozoite surface protein 1
    Species: Plasmodium falciparum, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ob1c1, d1ob1c2
  • Chain 'D':
    Compound: antibody, heavy chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1ob1d1, d1ob1d2
  • Chain 'E':
    Compound: antibody, light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1ob1e1, d1ob1e2
  • Chain 'F':
    Compound: Merozoite surface protein 1
    Species: Plasmodium falciparum, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ob1f1, d1ob1f2
  • Heterogens: CAC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob1A (A:)
    divmtqtpaimsaflgervtmtctatsslsssylhwyqqkpgsspklwiyttsnlasgvp
    srfsgsgsgtsysltissmeaedaatyychqfhhspytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob1B (B:)
    elqlvqsgpqlkkpgetvrisckasgytfttagiqwvqrlpgkdlkwigwinthsgvpqy
    addfkgrfafsletsastaflqiinlknedtatyfcarnyyrfdggmdfwgqgtsvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ob1C (C:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
    kcteedsgsngkkitcectkpdsyplfdgifcshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ob1C (C:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
    kcteedsgsngkkitcectkpdsyplfdgifcshhh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob1D (D:)
    divmtqtpaimsaflgervtmtctatsslsssylhwyqqkpgsspklwiyttsnlasgvp
    srfsgsgsgtsysltissmeaedaatyychqfhhspytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob1E (E:)
    elqlvqsgpqlkkpgetvrisckasgytfttagiqwvqrlpgkdlkwigwinthsgvpqy
    addfkgrfafsletsastaflqiinlknedtatyfcarnyyrfdggmdfwgqgtsvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ob1F (F:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
    kcteedsgsngkkitcectkpdsyplfdgifcshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ob1F (F:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
    kcteedsgsngkkitcectkpdsyplfdgifcshhhh