PDB entry 1oax

View 1oax on RCSB PDB site
Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone
Class: immune system
Keywords: immune system, antibody-complex, antibody, allergy, ige
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.238
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX (0-121)
    Domains in SCOPe 2.04: d1oaxh_
  • Chain 'I':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
  • Chain 'J':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX (0-121)
    Domains in SCOPe 2.04: d1oaxj_
  • Chain 'K':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
  • Chain 'L':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
    Domains in SCOPe 2.04: d1oaxl_
  • Chain 'M':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
    Domains in SCOPe 2.04: d1oaxm_
  • Chain 'N':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
    Domains in SCOPe 2.04: d1oaxn_
  • Chain 'O':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAX
    Domains in SCOPe 2.04: d1oaxo_
  • Heterogens: ANQ, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oaxH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oaxJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oaxL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaxL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oaxM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaxM (M:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oaxN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaxN (N:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1oaxO (O:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaxO (O:)
    avvtqesalttspgetvtltcrsstavttsnyanwvqekprhlftgliggtnnrapgvpa
    rfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl