PDB entry 1oav

View 1oav on RCSB PDB site
Description: omega-agatoxin iva
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1995-06-28, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: omega-agatoxin iva
  Species: Agelenopsis aperta [TaxId:6908]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30288 (0-47)
  Domains in SCOPe 2.08: d1oava_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oavA (A:)
  kkkciakdygrckwggtpccrgrgcicsimgtnceckprlimeglgla