PDB entry 1oau

View 1oau on RCSB PDB site
Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)
Class: immune system
Keywords: immune system, antibody-complex, antibody, allergy, ige, conformational diversity, multispecificity
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU (0-121)
    Domains in SCOPe 2.04: d1oauh_
  • Chain 'I':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oaui_
  • Chain 'J':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU (0-121)
    Domains in SCOPe 2.04: d1oauj_
  • Chain 'K':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oauk_
  • Chain 'L':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oaul_
  • Chain 'M':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oaum_
  • Chain 'N':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oaun_
  • Chain 'O':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAU
    Domains in SCOPe 2.04: d1oauo_
  • Heterogens: SER, DNF, IMD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oauH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1oauI (I:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauI (I:)
    gavkhrpamvyycarmfgttvs
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oauJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oauK (K:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauK (K:)
    gavkrpamvyycarmdwgttvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oauL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oauM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauM (M:)
    qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftglignnrapgvparfsgs
    lignkaaltitgaqtedeaiyfcgtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oauN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauN (N:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1oauO (O:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauO (O:)
    qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
    gslignkaaltitgaqtedeaiyfcgtkltvl