PDB entry 1oas

View 1oas on RCSB PDB site
Description: o-acetylserine sulfhydrylase from salmonella typhimurium
Deposited on 1999-01-29, released 2000-01-28
The last revision prior to the SCOP 1.59 freeze date was dated 2000-01-28, with a file datestamp of 2000-01-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1oasa_
  • Chain 'B':
    Domains in SCOP 1.59: d1oasb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oasA (A:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfadlf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oasB (B:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfadlf