PDB entry 1oaq

View 1oaq on RCSB PDB site
Description: Free conformation Ab1 of the IgE SPE-7
Class: immune system
Keywords: immune system, allergy, ige, conformational diversity, multispecificity
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.15965
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAQ (0-End)
    Domains in SCOPe 2.07: d1oaqh_
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAQ (0-End)
    Domains in SCOPe 2.07: d1oaql_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oaqH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaqH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oaqL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaqL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlg