PDB entry 1oap

View 1oap on RCSB PDB site
Description: Mad structure of the periplasmique domain of the Escherichia coli PAL protein
Class: lipoprotein
Keywords: periplasmic, peptidoglycan binding, tol system, outer membrane, lipoprotein
Deposited on 2003-01-20, released 2004-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan-associated lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oapa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oapA (A:)
lqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislger
ranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

    Sequence, based on observed residues (ATOM records): (download) 
    >1oapA (A:)
qqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerr
anavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy