PDB entry 1oap

View 1oap on RCSB PDB site
Description: mad structure of the periplasmique domain of the escherichia coli pal protein
Deposited on 2003-01-20, released 2004-02-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-13, with a file datestamp of 2004-02-13.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oapa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oapA (A:)
lqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislger
ranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

    Sequence, based on observed residues (ATOM records): (download) 
    >1oapA (A:)
qqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerr
anavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy