PDB entry 1oaj

View 1oaj on RCSB PDB site
Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, prokariotic cu, zn superoxide dismutase, subunit interaction recognition, protein electrostatic
Deposited on 2003-01-14, released 2003-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.191
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Photobacterium leiognathi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00446 (0-150)
      • engineered mutation (24)
      • conflict (30)
    Domains in SCOP 1.75: d1oaja_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oajA (A:)
    qdltvkmtdlqtgkpvgtielsqndygvvfipeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq