PDB entry 1oaj

View 1oaj on RCSB PDB site
Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Deposited on 2003-01-14, released 2003-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-27, with a file datestamp of 2003-02-27.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oaja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oajA (A:)
    qdltvkmtdlqtgkpvgtielsqndygvvfipeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq