PDB entry 1oai

View 1oai on RCSB PDB site
Description: complex between tap uba domain and fxfg nucleoporin peptide
Class: nuclear transport
Keywords: nuclear transport, nuclear transport factor, nucleoporin
Deposited on 2003-01-14, released 2003-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.149
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear RNA export factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oaia_
  • Chain 'B':
    Compound: fxfg nucleoporin peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAI (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oaiA (A:)
ptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakgeipevafmk

  • Chain 'B':
    No sequence available.